PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_00744
Common NameKK1_000764
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 488aa    MW: 54025.5 Da    PI: 4.6238
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_00744genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-173986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l+++vk++G g+W+++ ++ g+ R++k+c++rw ++l
    C.cajan_00744 39 KGPWTSAEDAILIEYVKKHGQGNWNAVQKYSGLARCGKSCRLRWANHL 86
                     79******************************************9986 PP

2Myb_DNA-binding50.54.9e-1692135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ ++++++ ++G++ W++ a++++ gRt++++k++w++
    C.cajan_00744  92 KGAFTAEEESRIIELHSKMGNK-WARMAAELP-GRTDNEIKNYWNT 135
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5223486IPR017930Myb domain
SuperFamilySSF466895.24E-3037133IPR009057Homeodomain-like
SMARTSM007172.6E-143888IPR001005SANT/Myb domain
PfamPF002491.0E-153986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-244093IPR009057Homeodomain-like
CDDcd001679.49E-124186No hitNo description
PROSITE profilePS5129424.22287141IPR017930Myb domain
SMARTSM007171.3E-1591139IPR001005SANT/Myb domain
PfamPF002491.2E-1492135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2594139IPR009057Homeodomain-like
CDDcd001672.71E-1194135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MSSMTSGGDT RKISKGRQSS SLVEEDGDGE NVGEGPLKKG PWTSAEDAIL IEYVKKHGQG  60
NWNAVQKYSG LARCGKSCRL RWANHLRPDL KKGAFTAEEE SRIIELHSKM GNKWARMAAE  120
LPGRTDNEIK NYWNTRIKRM QRAGLPIYPD EVYQRIHNAN QESQNVGTLT NEASQHDDLS  180
QTDNFDIQDG EFKNFKFCPG LSHGPSIFDM PQSSLFEQSS DTSHTYNILF PTMHPSKRRR  240
ESEILYNSFD SCTSNAVPVL DPYGNYNCER FSDHNSHAAL NGNASSSGPI FGSMKLELPS  300
LQYPETQHGS WGMYTPTSPL PSLESVDTLI QSPLVEPILS DPVSPQSCGL LEAIVYNSNT  360
LKGSRNDSLL PETTDTPYQA INNSILNLPF KTEWDEQEEP NSSLGQSAAS VLTDYTPVSI  420
SSVDGPQSVE TTQDSSGKKE NLNQIEFTRP DALLDLGWFG NNTEYGSDQS VLKDALSALL  480
GEDFQGEQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-31371395106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006605628.10.0PREDICTED: transcription factor GAMYB-like isoform X2
RefseqXP_014628523.10.0PREDICTED: transcription factor GAMYB-like isoform X1
TrEMBLA0A151SIG70.0A0A151SIG7_CAJCA; Transcription factor GAMYB
STRINGGLYMA20G11040.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-87myb domain protein 65